SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001464 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001464
Domain Number 1 Region: 411-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 327-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 467-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 373-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000643
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000001464
Domain Number - Region: 11-46
Classification Level Classification E-value
Superfamily SET domain 0.0458
Family Viral histone H3 Lysine 27 Methyltransferase 0.069
Further Details:      
 
Domain Number - Region: 64-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0673
Family C2HC finger 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001464   Gene: ENSTBEG00000001699   Transcript: ENSTBET00000001681
Sequence length 576
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3890:74951:79442:1 gene:ENSTBEG00000001699 transcript:ENSTBET00000001681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGEEYGQELGIKWGSKWKELV
ARREPRPEIHPCLSCSLAFSSQKFLNQHVEHNHSCQRSLRTSAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXFSLQSSLIRHQRTHTGEKPYLCGECGRGFSRQSH
LIIHQRTHTGEKPYVCRECGRGFSLQSNLIIHQRTHTGEKPYGCRECGRGFSQQSSLIRH
QRTHTGEKPYVCRECGRGFSRHSSLIIHQRTHTGEKPYLCGECGRGFSRQSHLIIHQRTH
TGEKPYVCRECGRGFSQQPQLIIHQRTHTGEKPYVCRECGRGFRCQSHLIIHQRTHTGEK
PYVCRECGRGFSQQPHLIIHQRTHTGEKPVCRKGEQ
Download sequence
Identical sequences ENSTBEP00000001464 ENSTBEP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]