SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002046 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002046
Domain Number 1 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-16
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 98-159
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-16
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Domain Number 3 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000007
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 293-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000261
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002046   Gene: ENSTBEG00000002375   Transcript: ENSTBET00000002363
Sequence length 431
Comment pep:novel scaffold:TREESHREW:scaffold_8851:1375:5583:1 gene:ENSTBEG00000002375 transcript:ENSTBET00000002363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHFGFTAKMLSEQTAVLGTGWESMNVQLDGAEHQVERGSREEGPWRTAPGPLEHLCCELE
EEPQSLQEKAQSAPWVPAVPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSL
DPSQTDFYGDYVMQECGIVVSLXXPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYT
GDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEQDENWDSMPRSSRGMHPNLPFLQENS
FSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLTRHQQIHTGERPYSCLKCEKSFGRRHHL
IRHQKTHLHDKPSRCAECGKNFRCNSHLASHQRVHAEGKSCEGQEVEETPGSRKRQRTPA
VPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQNP
RSTWDRGMSVF
Download sequence
Identical sequences ENSTBEP00000002046 ENSTBEP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]