SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002086 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002086
Domain Number 1 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 463-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 4 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 116-162
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 282-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000139
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 423-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000637
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 224-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000913
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002086   Gene: ENSTBEG00000002418   Transcript: ENSTBET00000002410
Sequence length 565
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5842:9500:18621:1 gene:ENSTBEG00000002418 transcript:ENSTBET00000002410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSCKPGLVSQLRPRPEPKGAECGILHATGTDWESQLKAREATTLQDSLEGALSSAVPMG
MKAAVQIQRVVAQTPAPDLPDTQVTWAAALPAQDPVWLQEDSMEEEAMVSGLLTPCSQEQ
VTFADVAVVFTPEEWVFLDAAQRSLYREVMLENCRNLASLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPQFQPQESVPSPDVSGGIPPMGMKTELPQPGGKPYRCDELGKPFNSI
EPPLQYQKIHPGEAPFECQESRNSFFQSTHLILPEKMRSGDKAYACDKCDKSFRYGSDLL
RHKKTHTTEKYFECLECRQAFKYSSNLRRHMRTHTGEKPYECSQCGKTFTRNFNLILHQR
NHTGEKPYACKDCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREHSSLKTHLRTHTR
EKPYECNQCGRPFRTSTHLNVHKRIHTGEKLYECGTCGQVLSRLSTLKSHMRTHTGEKPY
VCQECGRAFSEPSSLRKHVRTHTGKKPYTCQECGRAFGQSSHLIVHVRTHTAGRPYPCNQ
CDKAFRHSSSLTVHKRVHVGRESLG
Download sequence
Identical sequences ENSTBEP00000002086 ENSTBEP00000002086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]