SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002327 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002327
Domain Number 1 Region: 492-688
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-20
Family SPRY domain 0.0054
Further Details:      
 
Domain Number 2 Region: 187-246
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 4-43
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000103
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002327
Domain Number - Region: 230-320
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002327   Gene: ENSTBEG00000002693   Transcript: ENSTBET00000002687
Sequence length 707
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3322:72666:99606:-1 gene:ENSTBEG00000002693 transcript:ENSTBET00000002687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLTLDDSFNDVGSDNSNQSSP
RLRLSSPSMDKIDRINRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXILMCPEHETERINMYCELCRRPVCHLCKLGGNHSNHRVTTMSSAYKTLKEKLS
KDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAITHFEKLFEILEERKSSVLKAI
DASKKLRLDKFQTQMEEYQGLLENNGLVGYAQEVLKETDQSCFVQTAKQLHLXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXFSFLFDEKCGYNNEHLLLNLKRDRVESRAGFNLLLAAERIHVGYYTSLD
YIIGDVGITKGKHFWAFRVEPYSYLVKAGVASSDKLQEWLRSPRDAVSPRYEQDSGHDSG
SEDASFDSSQPFTLVTIGMKKFFIPKSPTSSNEPESRVLPMPASIGVFLDYDKGRVSFYD
ADHMKCLYERQVDCSHTMYPAFALMGSGGIQLEEPITAKYLEYHEDM
Download sequence
Identical sequences ENSTBEP00000002327 ENSTBEP00000002327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]