SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003265 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003265
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily SIS domain 3.34e-83
Family Phosphoglucose isomerase, PGI 0.00000000307
Further Details:      
 
Domain Number 2 Region: 290-422
Classification Level Classification E-value
Superfamily SIS domain 9.45e-56
Family Phosphoglucose isomerase, PGI 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003265   Gene: ENSTBEG00000003747   Transcript: ENSTBET00000003763
Sequence length 423
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1065:6305:32505:1 gene:ENSTBEG00000003747 transcript:ENSTBET00000003763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSRNPQFQKLQQWHRNHGAELNLRSLFEGNKERFNRFSLNLDTGHGHILVDYSKNLV
TEEVMQMLVDLAKSRGVEAARDHMFNGEKINFTENRAVLHVALRNRSNTPILVDSKDVMP
EVNRVLDKMKAFCQRVRSGDWKGYTGKTISDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWFVSNIDGTHIAKTLAALNPETSLFIIASKTFTTQETITNAETAKEWFLQSAKDXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDNFEQLLSGA
HWMDQHFRTAPLEKNAPVLLAMLGVWYINCFGCETQALLPYDQYMHRFPAYFQQGDMESN
GKYITKSGTRVDHQTGPILWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHK
Download sequence
Identical sequences ENSTBEP00000003265 ENSTBEP00000003265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]