SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003363 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003363
Domain Number 1 Region: 112-190
Classification Level Classification E-value
Superfamily Serpins 0.0000000000262
Family Serpins 0.0029
Further Details:      
 
Domain Number 2 Region: 292-336
Classification Level Classification E-value
Superfamily Serpins 0.0000117
Family Serpins 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003363   Gene: ENSTBEG00000003876   Transcript: ENSTBET00000003872
Sequence length 337
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2411:70706:79735:1 gene:ENSTBEG00000003876 transcript:ENSTBET00000003872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRLTPLTLLLLLLAGDRASSKLDVTGHGFRDSESPEGGSKGHTLEGSISKNLSSQHIK
ESSLTKNSTTNSTTNSTISTTTKRTANTTTEHTTQPSTQPTSQLTIRPTTQPTTQPTTEP
FCPGPDTLCSDLEKQSAEAILGEALVDFSLKLYHAFSAMKKPETNMAFSPLSIASLLTQV
LLGAAESTEDLENLSYPDFCVHALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWKTTFDTQ
KTRSEPFYYKGSMIKVPMMTSKKYPVAHFTDSTLKAK
Download sequence
Identical sequences ENSTBEP00000003363 ENSTBEP00000003363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]