SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003642 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003642
Domain Number 1 Region: 48-255
Classification Level Classification E-value
Superfamily Serpins 2.62e-57
Family Serpins 0.00000000442
Further Details:      
 
Domain Number 2 Region: 390-460
Classification Level Classification E-value
Superfamily Serpins 2.09e-25
Family Serpins 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003642   Gene: ENSTBEG00000004209   Transcript: ENSTBET00000004206
Sequence length 463
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5544:281461:297972:-1 gene:ENSTBEG00000004209 transcript:ENSTBET00000004206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSQEGTEASGKRRVCFLSLLLAGLWGCVICHWSPVEDICTAKPRDIPVNPMCIYRSPEK
KTTEEEGSEQKIPEATNRRVWELSKANTRFATTFYQHLADSKNDNDNIFLSPLSISTAFA
MTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSTLVSANRLFG
DKSLNFNETYQDISEAVYGAKLQPLDFKGNAEQSRAIINKWISNKTEGRITDVIPPEAID
ELTVLMLVNTIYFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXIVAEGDSLYVSDAFHKAFLEVNEEGSEAAASTVIT
IAGRSLNPNRVTFKANRPFLVFIREVALNTIIFMGRVANPCVN
Download sequence
Identical sequences ENSTBEP00000003642 ENSTBEP00000003642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]