SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003643 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003643
Domain Number 1 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 5.41e-23
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 451-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 3 Region: 101-162
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.58e-17
Family B-box zinc-binding domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003643
Domain Number - Region: 147-230
Classification Level Classification E-value
Superfamily OmpH-like 0.0235
Family OmpH-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003643   Gene: ENSTBEG00000004210   Transcript: ENSTBET00000004209
Sequence length 516
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5685:4014:21706:1 gene:ENSTBEG00000004210 transcript:ENSTBET00000004209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCSQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPG
ELKRLVESRRQQILREFEELHRRLDEEQQLLLSRLEEEEQDILQRLRENAAHLGDKRRDL
AHLAAEVEGKCLQSGFEMLKDFFGGRVIMNTPRKFLGKIRIWSGNHEPYRLIKSSRCEKV
KTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVGIFLDYEAGTLSFYNVTDRSHIYT
FTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE
Download sequence
Identical sequences ENSTBEP00000003643 ENSTBEP00000003643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]