SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003700 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003700
Domain Number 1 Region: 737-964
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-58
Family DBL homology domain (DH-domain) 0.00000000121
Further Details:      
 
Domain Number 2 Region: 968-1102
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-43
Family Pleckstrin-homology domain (PH domain) 0.000000275
Further Details:      
 
Domain Number 3 Region: 370-515
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-24
Family Regulator of G-protein signaling, RGS 0.00000141
Further Details:      
 
Domain Number 4 Region: 65-101
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000096
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003700   Gene: ENSTBEG00000004195   Transcript: ENSTBET00000004278
Sequence length 1545
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1385:24621:127743:-1 gene:ENSTBEG00000004195 transcript:ENSTBET00000004278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSLSSLGDSAPERKSPSHHRQPSDTSETTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDILPLYGDASQRPSEGR
LSLDSQEGDSGLDSGTERFLSLSESLMNRNSVPSDPGLDSPRTSPVIMARATQHHRRQGS
DAPVPPTSDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLFYLCAEVYQQANPKDSRSLGKDIWNIFLEKNAPLRVKVPEMLQVEIXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRTLGLGSLYGENDLLDLDGDPLRERQVAE
KQLAALGDILSKYEEERSAPMDFALNTYMSHAGIRLREARPTSTTEKAQAAPDKDKWLPF
FPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQH
FENNQQCDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKTENVP
RSRSDVDMAAETRLHQSASASALTRSLENPTPPFTPKMGRRSIESPSLGFCTDPLLPHLL
EDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVINELFVTENLHLRTLQVLD
LIFYQRMKKENLMPREELTQLFPNLPELIEIHNSWCEAMKKLREEGPIIREISDLMLARF
DGAAREELQQVAAQFCSHQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIIS
EMQRLTKYPLLLESIIKHTEGSSSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQ
KRLDATALERASNPLAAEFKSLDLTTRRMVHEGPLTWRISKDKTLDLHVLLLEDLLVLLQ
KQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIY
ELVALTSSDKNTWMELLEEAVRHATRHPGAAXXXXXXXXXXXXXXXXXXXXXXXGGLEDS
EVFHSEPEPEEQPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XNCFYVSMPAGPSDSSTDPSGAPCSPSQPDSLPTWQTEHPTQLRAGHGGQRRASHSLPSL
ASRDVGMIFRTIEQLTLKLNRLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSDTPPEDGTADTAMSPGL
Download sequence
Identical sequences ENSTBEP00000003700 ENSTBEP00000003700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]