SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003771 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003771
Domain Number 1 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 2.32e-32
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 340-596
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-31
Family Kelch motif 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003771   Gene: ENSTBEG00000004375   Transcript: ENSTBET00000004365
Sequence length 677
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1802:24163:26242:-1 gene:ENSTBEG00000004375 transcript:ENSTBET00000004365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREDAPRSRRLSSPRGGRRPKRLSKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQASVTMHDVDAE
SFEVLVDYCYTGHVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFA
DAFDHHKLRCQAQSFIAHNFKQLSRMGSVREETLADLTLAQLQAVLRLDSLDIESEQTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDIIEGALQ
MRYGDMLYKSLVPKPNSSSSSVVSAAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSGD
IYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCR
EGMDVAYLNGYIYILGGRDPVTGVKLKEVECYSVQRNQWALVAPVPHSFYSFKLVVVQNY
LYAVTSTAMLCYDPSXXXXXXXXXXXXXXXXXXXXXNDKIYLIYKIPVMKLYPARGEWRR
ISNIPLDSETHNYQIVNHDQKLLLITSTPQWKKTRVTVYEYDTRGYQWINIGTMLGLLQF
DSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDDEV
WVQVAPQRNAQDQQGSL
Download sequence
Identical sequences ENSTBEP00000003771 ENSTBEP00000003771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]