SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003918 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003918
Domain Number 1 Region: 524-555,636-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003918   Gene: ENSTBEG00000004521   Transcript: ENSTBET00000004544
Sequence length 729
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1755:776003:810500:-1 gene:ENSTBEG00000004521 transcript:ENSTBET00000004544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSVNTFAEEHKKKDRYHKTFLDHLKHCCRCSPQKAKKIALSLFPI
ASWLPAYQLQKWLLSDIVSGISTGLVAVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPFPVLSMMLGLAVENVASTLHVTTTNSSDSTVSNASVSMEEKVTVAATITIL
CGLIQLIMGVLQIGFVVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPPHTDPFSIFK
VLQSIFTQIKDTNIPDLVTSLIILVIVSAVKEVNQRFKAKLPVPIPIEFIMTVIATGVSY
GFDFQHRFNVSVVGTMQKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXAGSTALSRSAVQESTGGKTQIASFFSALIVLIVI
VGIGFLLEPLQKSVLAALALGNLKGMLMQFSEIGRLWRKDKYDCLIWIMTFIFAIVLGLG
LGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYSDMYEPEGVKIFRCPSPIY
FANIRFFKQKLIDAVGFSPLRILRKRNKTLKKIKKLLNEGLLQVTPEGFLCIADGIKDSD
SEEVDNNQVEELHQPITTDLPFQIDWNTYPLKVLVPQVTLHSLILDFSAVSFLDVSSMRG
LKTILQEFIRIEVDVYIVGTDDDFMEKLARCEFFDDEVKDTIFFLTIHDAVLHILMKKDY
STSKFNFSQ
Download sequence
Identical sequences ENSTBEP00000003918 ENSTBEP00000003918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]