SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004220 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004220
Domain Number 1 Region: 367-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 311-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 54-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004220   Gene: ENSTBEG00000004913   Transcript: ENSTBET00000004902
Sequence length 426
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6116:185423:245451:1 gene:ENSTBEG00000004913 transcript:ENSTBET00000004902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWRNVRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSVTFE
DVAVYFSWEEWDLLTETQRRLYLDVMLENFALTSSLGCWHEVDLDEAPSEQSISLQGGSQ
VRALREGSSSLNACPCEICGLVLRDCLDLAGHHRHHRQKPCTCEKQSCFTANLPQHRHIR
EIPFKSYEDTDSFIKSCTIHVSRKPFTYREVKKGFLTSMRFLHQQATYIRKKPNKYGVAF
GSKKSQHNWGENKAFSHTDVLIQDQSILTREGLFECTKCGKACTRRCNLIQHQKVHSEER
PYECSVCGKFFTYYSSFIIHQRVHTRERPYECSECGKCFSQIYSLNSHRKVHTGERPYEC
GECGKLFSQRSNLVQHRRVHTGERPYECSECGKSFSQNFSLIYHQRVHTGERPHECSECG
KSFSRS
Download sequence
Identical sequences ENSTBEP00000004220 ENSTBEP00000004220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]