SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004383 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004383
Domain Number 1 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 511-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 317-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 212-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000235
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004383   Gene: ENSTBEG00000005093   Transcript: ENSTBET00000005087
Sequence length 575
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5461:20830:27422:1 gene:ENSTBEG00000005093 transcript:ENSTBET00000005087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYERKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVPARAHGHRVLWEEVVRSESTPEPPSAQPQPATTQHMSPAPHR
PPERATSASQSPSSQKGSSGDQEMTTTLLTAGLQTLEKIEDMAVSLIREEWLLDPSQKDL
SRNNMPESFRSMFSLGAETKNEDRELTSKQVISTRIQPLGETAAKCNGDVIRGLEDREAR
DLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFSYRS
ALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCSQCGKAFSQSAGLIL
HQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQRS
HTGEKPYKCSECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTGE
KPYQCNECGKAFIQRSSLIRHQRIHSGEKSESIGV
Download sequence
Identical sequences ENSTBEP00000004383 ENSTBEP00000004383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]