SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005338 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005338
Domain Number 1 Region: 435-600
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-37
Family Kelch motif 0.001
Further Details:      
 
Domain Number 2 Region: 39-162
Classification Level Classification E-value
Superfamily POZ domain 5.89e-27
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005338   Gene: ENSTBEG00000006186   Transcript: ENSTBET00000006199
Sequence length 607
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1745:242991:299020:1 gene:ENSTBEG00000006186 transcript:ENSTBET00000006199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLLAQPSTLSGAANGPPTADSAHGLQMLRTIGVGKYEFTDPGHPKEMLKELNQQRRAKA
FTDLKIVVEGREFEVHQNVLASCSLYFKDLIQRSVQDGSQGGREKLELVLSNLQADVLEL
LLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMPEAMQ
CSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKK
DPTARAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXYDTITNQWEAVPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVL
QSYVPQTNTWSFIESPMIDNKYAPAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMN
HSRQFCSAVVLDGKIYATGGIVSSEGPALGNMESYEPATNTWTLLPHMPCPVFRHGCVVI
KKYIQSG
Download sequence
Identical sequences ENSTBEP00000005338 ENSTBEP00000005338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]