SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006362 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006362
Domain Number 1 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 264-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 77-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000115
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006362   Gene: ENSTBEG00000007373   Transcript: ENSTBET00000007364
Sequence length 337
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_973:39263:45563:-1 gene:ENSTBEG00000007373 transcript:ENSTBET00000007364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSEVLSEDMVSLGTGGQFQKRQAEECSLEEGAQRTSQQPPSQLSYRPKRVPLLWPERGPP
ASQDQEMALPSSFLSACSQVPGTLEDVTVYLSGEEQGSLDRAQWDHSCDVLPENEENEGL
GIQLEDGGDAREDALLRMEWYRVLSAQCPGPGLPCPPLVGPERPGGCPRQAGAGPRGADK
PFTCPECGKGFSKTSHLTKHQRTHTGERPYKCPVCGKGFSDRSNFSTHQRVHTGEKPYGC
PECGKRFSQSSSLVIHRRTHTGERPYVCAQCGKSFSNSSHFSAHRRTHTGEKPYACPVCG
RGFRRGTDLHKHQRTHAGDGSPPKHQPAALGGPGAKA
Download sequence
Identical sequences ENSTBEP00000006362 ENSTBEP00000006362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]