SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006777 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006777
Domain Number 1 Region: 374-631
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-81
Family Kelch motif 0.00000121
Further Details:      
 
Domain Number 2 Region: 137-210
Classification Level Classification E-value
Superfamily POZ domain 0.000000000785
Family BTB/POZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006777   Gene: ENSTBEG00000007829   Transcript: ENSTBET00000007831
Sequence length 636
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3816:188090:240419:1 gene:ENSTBEG00000007829 transcript:ENSTBET00000007831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEIRWRWFGHASAPNSTVDSQQGEFWNRGQTGASGGRKFLDPCSLQLPLASIGYRRSSQL
DFQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSGSSQ
TLSSCHTMEPCSSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHRLELKE
ENIECLLSTACLLQLSHVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTME
HFMEVIRNQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLA
YIRLPLLAPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKT
LNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQ
WNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTPCAQMSKRRGG
VGVTTWNGLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLG
DKLYAVGGYDGQTYLNTVEAYDPQTNEWTQLFVNSF
Download sequence
Identical sequences ENSTBEP00000006777 ENSTBEP00000006777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]