SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006959 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006959
Domain Number 1 Region: 131-261
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-17
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006959   Gene: ENSTBEG00000008043   Transcript: ENSTBET00000008039
Sequence length 286
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5775:75920:309180:1 gene:ENSTBEG00000008043 transcript:ENSTBET00000008039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVT
ELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLE
MEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQG
Download sequence
Identical sequences ENSTBEP00000006959 ENSTBEP00000006959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]