SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007738 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007738
Domain Number 1 Region: 1147-1342
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000244
Further Details:      
 
Domain Number 2 Region: 953-1060
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-26
Family Pleckstrin-homology domain (PH domain) 0.00000167
Further Details:      
 
Domain Number 3 Region: 104-156
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000237
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007738   Gene: ENSTBEG00000008905   Transcript: ENSTBET00000008928
Sequence length 1961
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1201:4324:157581:-1 gene:ENSTBEG00000008905 transcript:ENSTBET00000008928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDKLKAFGAPACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQRNRLEPMDTIFVKQVKEGGPAFEA
GLCTGDRIIKVNGESVIGKTYSQVIALIQNSDKPLLIGMPEDEDILQVLQFTKDVTALAY
SQDAYLKGNEAYSGNARNIPEPPPICYPWLPPAPSTVSQPVEISPPDSSSSKQQTSTPVL
SQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSSRNNHTGPSHR
TEEMRYGRNEQTSLKTVSRTMSPPSSIPTAHLIHQTAGSRSLEASGILLKSGNYSGHSEG
ISSSRSQAVDSPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRA
ASQSTADYNQVVPNRTALQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSAS
QGALTSPPVSFSNHRTRSWDYIEGQGENVENVSSEGQIPDPNEERKQTYKWSGFTEQDDR
RGIYERPRQQEIHKSFRGSNFTVAPSIVNADNRRMSSRGVGSGAQFKKIPPDLKTLQSNR
NFQAPCGMSLARGVSQDRSPLVKVRSNSLKAPSTHVTKPSFSQNSFVPIKDQRPVNHLHQ
NSLLNQQTWLRTESAPDHQGEPRKSPSLSGPSAKPAPQMSENSGPSDLELPVSQQSRDLN
LHEAEIPQADALDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDA
RREVHMKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPS
IATVPPSLTTSAPLIRRQLSHDHESVGPPSLDAHPSSKTERSKSYDEGLDDYREDAKLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVGGSIRP
WKQMYVVLRGHSLYLYKDKREQVTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCE
CLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKPEQLPKTPRQ
SLSIRQTLLGAKSEPKMQSPHSPKEESERKLLGKDDTSPPKDKGTWRKGIPSIMRKTFEK
KPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQE
ELNKGMTDIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLR
TLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHM
VTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEENTVESQPVPNIDHLLTNIGRTGV
SPGDVSDSATSDSTKSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTNAETSKRKN
IKRRHTLGGHRDATEISVLNFWKVHEQSVERESELSAVNRLKPKCSAQDLSISDWLARER
LRTSASDLSRGETGDPQLENPGMLETSMTETLLAFQSETGSSSSTLASTARPLLSTPPQS
PDQINGESFQNGSQNVSSAANAQPHQLSAAPGNKAQLHPCL
Download sequence
Identical sequences ENSTBEP00000007738 ENSTBEP00000007738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]