SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008025 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008025
Domain Number 1 Region: 803-993
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1e-55
Family Adenylyl and guanylyl cyclase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 503-738
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.41e-37
Family Protein kinases, catalytic subunit 0.00052
Further Details:      
 
Domain Number 3 Region: 29-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.94e-22
Family L-arabinose binding protein-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008025   Gene: ENSTBEG00000009245   Transcript: ENSTBET00000009265
Sequence length 1066
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4435:354386:478414:-1 gene:ENSTBEG00000009245 transcript:ENSTBET00000009265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLLSLALWLLLFQPGMMFLSDVSRNCHDGTYEITVLMMNNSAFPETLNNLEIAVNEG
LKIVKQRLDEAGMNVTVNASFIRSKDVIYKSSDCRSSTCEGLDLLRTISTQKQMGCALMG
PSCTYSTYQMYPTRLNYPKISAESFLSCDYKETLTRMMAPARKLMYFVINFWKATNMAIK
PFPWNTAYVYKDGTETEDCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSNS
NIVMCGSPKLIQSLKGDRAMNEDTVIILMDLFNNYYFEDNVTAPDYMKNVLVLTLDFKNS
ILNDSLINQLLPAKYEFALAYLDGILLFGHVLQKFLENGEDVTGPEFAHAFRNLSFTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXYKTLLTYNTHLNTSTTVDSSPTFTWKNHKLPNDI
PGGGPQVLMIAVFTLTGTVVLLLLIALLVLRKYKKDNELRQKKWSHIPPENIYPLETNET
NQVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIDLNKLLQIDYYNL
TKFYGTVKLDSMIFGVIEYCERGSLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMSYL
HSSKTEVHGRLKSTNCVVDNRMVVKITDFGCNSILPPKKDLWTAPEHLRQASVSQKGDVY
SYGIIAQEIILRRETFYTLSCRDQNEKIRVESNGKPFRPDLFLETAEEKELEVYLLVKSC
WEEDPEKRPDFKKIENTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYK
AERDRADRLNFMLLPRLVVKSLKEKGIVEPEFYEEVTIYFSDIVGFTTICKYSTPMEVVD
MLNDIYKSFDQIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALDILSFMGTF
ELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLXXXXXXXXX
XXXXXXXXXXXFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPVPPTVENQQRLQAEFS
DMIANSLQKRQASGVRSRKPTRVASYKKGTLEYLQLNTTDKEGTYF
Download sequence
Identical sequences ENSTBEP00000008025 ENSTBEP00000008025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]