SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008302 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008302
Domain Number 1 Region: 427-644
Classification Level Classification E-value
Superfamily TPR-like 6.83e-32
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 599-815
Classification Level Classification E-value
Superfamily TPR-like 7.59e-25
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000008302
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0445
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008302   Gene: ENSTBEG00000009587   Transcript: ENSTBET00000009589
Sequence length 912
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4025:215565:258563:1 gene:ENSTBEG00000009587 transcript:ENSTBET00000009589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDINLKEITLIVGMVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLFSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVTGVVGRAELLSSIFFLAAFLSYTKSKGPNNSIVWTSIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALLMALPFIX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLKKLSWVCLSMVILTHALKT
LHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDIG
AHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRAN
ESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWY
NLAIVHIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSYI
NEEPQDANGYFNLGMLAMDDKKDTEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELKA
LPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVVY
FEEKDLLKAERCLVETLALAPHEEYIHRHLSIVRDKISSATFIEQPIFPGGKTSGVEGNK
IPAENVKEIRSQSRPTQIISDNKSQSKSNKQLGENTDKETPHKTTKDIKEIEKKRVAALK
RLEEIERILNGE
Download sequence
Identical sequences ENSTBEP00000008302 ENSTBEP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]