SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008638 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008638
Domain Number 1 Region: 372-607
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-71
Family Kelch motif 0.00000000031
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 6.8e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008638   Gene: ENSTBEG00000009989   Transcript: ENSTBET00000009981
Sequence length 623
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1076:205812:220368:-1 gene:ENSTBEG00000009989 transcript:ENSTBET00000009981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDPRPSGAGARSRFLPLRSQCPKGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCAELHQRAREYIYMHFGEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXVGGLLYVGGRNNSPDGNTDSNALDCYNPMTNQWSPCAPMSVPRNRIGVGVI
DGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGT
NRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVET
ETWNFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGR
SGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences ENSTBEP00000008638 ENSTBEP00000008638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]