SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009129 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009129
Domain Number 1 Region: 130-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-23
Family Ankyrin repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 20-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000571
Family Ankyrin repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 235-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000693
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009129   Gene: ENSTBEG00000010548   Transcript: ENSTBET00000010554
Sequence length 278
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4768:389747:442326:-1 gene:ENSTBEG00000010548 transcript:ENSTBET00000010554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQAAEGCYLGDVGFLVEGTPVQEAAQRCESLQLQQLIESRACVNQVTVDSITPLHAAS
LQGQAKCVQLLLAAGAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSSECVRLLIDAGPDLKAHECHFGTPLHVACARKHLDCVKVLLKAGTNVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
TLSQLCRVSLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Download sequence
Identical sequences ENSTBEP00000009129 ENSTBEP00000009129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]