SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009305 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009305
Domain Number 1 Region: 4342-4437
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-19
Family PDZ domain 0.00000909
Further Details:      
 
Domain Number 2 Region: 907-976
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000388
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.018
Further Details:      
 
Domain Number 3 Region: 4630-4677
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000458
Family Synaptotagmin-like (S variant) 0.00032
Further Details:      
 
Domain Number 4 Region: 4857-4986
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000134
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009305
Domain Number - Region: 426-486
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000129
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009305   Gene: ENSTBEG00000010659   Transcript: ENSTBET00000010761
Sequence length 4990
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5200:57765:579269:-1 gene:ENSTBEG00000010659 transcript:ENSTBET00000010761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNASLRGGLSLAAAAAVLRKAGREPLHTVIGCMEDLQLEEERXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPAQSGAAEASSSQGEVRPSS
QQDGPKVVGQLLGLGKTSAQQPGPGMSAQQLGSPKPPAQPEPLSTSKTPGTTKAPAQQPG
PGKTPAQQPGPGKPPAQQSGPTKTSSQQSSPAKPPLQQPSPAKPSAQQAAKPVSQIGTGK
PLQPATSSPSAAQTPVQGLPKTICPLCNTTELLLHVPEKANFNTCTECQTTVCSLCGFNP
NPHLTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESSPKPAPPKEPSVPSEQA
KPPVADEKPKQPKTVKPPTDTVSSSAATKPDIPSPKVQSQVQDKTTPPLKTDSAKPSQSF
PPTGEKVTPFDSKAIPRPASDSKIISQPEPSSESKVQKQVDPIQKKEEPKKAQSKMSPKP
DAKPMPKGSPTPPGPRLTSGQTAPASQQPTKPQEQSRRFSLNLGSITDAPKSQPTTPQET
VTGKLFGFGASIFSQASNLISTAGQPGPHSQSGPGASTKQAPLPSQPPASQGPPKSTGQG
PSAAPAKVMPMKKETKAPVTEKLEPKVEQAPTVKRTEAEMKVPPIKDSKPLAAEPQKTDL
PLKPEKSPKLELTCPLCKTELNIGSQDPPNFNTCTECKKQVCNLCGFNPTPHLTEIQEWL
CLNCQTQRAMSGQLGDMGKMLPAPSGPKAPPMPVPTEPTSQKTTMPAQVKVIKKEQEIKA
DAEKAIPEKGKETPSTEKIPRKVTTDQKQEEKKLEKEKSSSLQEKKPLPEEKKVAFEEKE
PPPEEKKLPPEEKKPTPEDKKLPPLAKTSVLEEEQKHDLLKTQAQIAHEEPEGRVAPEAI
QEEKQAETLVEKLPSDLPQSLPKEDDKTTTKIKEQPQAASIAKLVFMYLFLSAEKEDDKS
DTSSSQQPKSPQGLSDTGYSSDGISGSLGEIPSLIPSDEKDLLKGLKKDTFSQESSPSSP
SDLAKLESTVLSILEAQASTFVDEKPEKKTQPHGISPEQPKDQQKTHVLSETLESTISEI
ELKVSPEEQKDISKKDSQPSLSSSKDHKEKSEFVDDIATRRQPYDSVEDSSESENSPVPQ
RKRRTSVGSSSSDEYKHEDSQGSGEEEDFIRKQIIEMSADEDASGSEDDEFIRSQLKEIS
SSTESQKKEETKGRGKATPGKHRRLTRKSSASFDDEAGRRHSWHDEDDETFDESPELKYR
ETKSQESEELVVAGGGGLRRFKTIELNSTIADKYAADSTPKKTALYFDEEPELEMESLTD
SPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKGESKQQRKARHRSHGPL
LPTIEDSSEEEELREEEELLKEQEKQRELEQQQRKSSSKKSKKDKDELRAQRRRERPKTP
PSNLSPIEDASPTEELRQAAEMEELQRSSCSEYSPSIESDPEGFEISPEKIIEVQKVYKL
PTAVSLYSPTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNERDDVFEKEPL
YGGMLIEDYIYESLVEDTYNGSVDGSLLTRQEEENGFLQQRGKEQKLRLTEQIYEDPMQK
ITDLQKEFYELESLHSVVPQEDIVSSSYIIPESHEIVDLGTMVTSSSEEKKLLDADAAYE
ELMKRQQMQLTPGSSPTQHPIGDDLTESTLDFDRAPDASLTSSVLSGASLTDSTSSATLS
IPDVKITQHFSTEEIEDEYVTDYTREIQEIIAHESLILTYSEPSESATSVPPSDTPSLTS
SVSSVCTTDSSSPITALDSIATVYTEPLDVITKFEDSEEISSSTYFPGSIIDYPEEISIS
LDQTTAPEGRTSADHVVISLSDIAPSMIESVETKPEEAIADTISTDLSISEKDAMKKVKK
ETENGIILEVLEAYKDKMEVSEAERTKQSLSAPPMKEPLSTTYFISREIFPQEKPASHLP
SGSPSVSSLPIKTRPFLRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPPLPPSTSPKPS
IHPKKKLTVAAPVTLPSTAAPPVDAVTTVETTAISRSNGLPVTKICATAPPPVPPKPSSI
PTGLVFTHRPEPSKPPIAPKPAVPQLPVTTQKPTDTHPKPIGLPLTSSMTLNLVTSAEYK
LPSPTSPLSPHSNKSSPRFSKSLMETYVVITLPSEPGTPTDSSASQTITSWPLGSPPKDL
VSIEPVFSLVPPITAAEISSSSEQTLHISGALETLSTAPIATLSSFQAIPTSVTHFLTSE
VSKAEVSAARSAAPSVGLGSVSISIPPEPLALDNLHLEKHQYRENGKVQLVGDVIDLRTV
PKVQVKATERCMDLSASTMDMKRQTTSNEAYGRQISAVQPSIINLSTTSSAVPAISLDTK
TVTVVTCTASVSYTTSTESLLSKEHAMTTPLQLTTSKHAEPPYRMPSSQAFHTVREEAPI
NLSLGTSAHAVTLAVTKPVTVPPVGVTNGWTDSTTTLGITDGEVVDLSTTKSHRTVITMD
DSTSGVVTKIIEDDEKPVDLTAGRRAVCCDVVYKLPFGRSCTAQQPATTLPEDRFGYRDD
HYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFDYSGGTDAAVDLTSGRITA
GEVMDYSSKTTGPYPETRQVISGVGISTPQYSTARMTPPPGSQYGVGSVLRSSNGVVYSS
VATPVPSTFAITTQPGSIFSTTVRDLSGIHTTDAVTSLSGLQQSQPMPRSYFITTGASET
DIAVTSIDINASLQTITVETLTAETIDSVPTLTTASEVFSEVVGDESALLIVPEEDKQQQ
QLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQSMKQHLLYQQE
EERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEEQKIRQIYQYNYDPSGTASPQTTT
DQAILEGQYAAPEGSQFWASEDATTTASAVVAIEIPQSQGWYTVQSDGVTQYIAPPGILS
TVSEIPLTDVVVKEEKQPKKRSSGAKVRGQYDEIGENMADDPRCFKKIVDSGVQTDDEDA
ADRSYANRRRRTKKSVDTSVQTDDEDQDEWDMPTRSRRKTRVGKYGDSTTEADKTKXXXX
XXSIAVQTVAEISVQTEPVGTIRTPSIRARVDAKVEIIKHISAPEKTYKGGSLGCQTETD
SDTQSPQYLSATSPSKDKKRPTPLEIGYSSHLRADSTLQLAPSPPKSPKVLYSPISPLSP
GKALESAFVPYEKPLPDDISPQKVLHPDMAKVPPASPKTAKMMQRSMSDPKPLSPTADES
SRAPYQYTEGFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXMARAKILQDIDRELDLVERESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEAL
LKEREKRERAYLQGVAEDRDYMSDSEVSSTRPTRIESQHGIERPRTAPQTEFSQFIPPQT
QTESQLVPPTSPYTQYQYSSPALPTQAPTPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVA
TMSFTPQAQPTPAPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYEVIRNQPLMIAPVS
TDSTYAVSHLGSKYNSLDLRIGLEERSSMASSPISSISADSFYADIDQHTSRNYVLIDDI
GEITKGTAALSTAFSLHEKDLSKTDRLLRTTETRRSQEVTDFLAPLQTSSRLHSYVKAEE
DPMEDPYELKLLKHQIKQEFRRGTESLDHLSGLSHYYHADTSYRHFPKSEKYSISRLTLE
KQAAKQLPAAILYQKQSKHKKSLIDPKMSKFSPIQESRDLEPDYSSYMTSSTSSIGGISS
RARLLQDDITFGLRKNITDQQKFMGSSLSTGLGTLGNTLRSALQDEADKPYSSGSRSRPS
SRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFGHASSSARTKPSLPARXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSR
PLSQHQEQVIQMNGKTVHYIFPHSRIKITRDSKDHTVSGNGLGIRIVGGKEIPWHNGEIG
AYIAKILPGGSADQTGKLIEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRLDLN
MLSDSENPQHLELHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSSVVEKGSHAH
SGPASAGSSSVPSPGQPGSPLVSKKKHSSSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES
IDHGKSHSSQSSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLR
SHGPSRSQSKTSVTQTHLEDAGAAIAAAEAAVQQLRIQPTKPTNHRPAESSVSTGSSGSS
FGSGYSVDSEGSSSTAGETNLFPIPRIGKMGQNGQEPVKQPGIGVGLADTEVKTQVMGEI
KIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLYVKIYVMNIATQKVIKKKTXXX
XXXXXXXXXXXXXXXXXXXXXXXXILLFSNGGKFMKKTLIGEACIWLDKVDLRKRIVNWH
KLLVSPTQTH
Download sequence
Identical sequences ENSTBEP00000009305 ENSTBEP00000009305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]