SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009675 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009675
Domain Number 1 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 303-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 110-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000279
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009675
Domain Number - Region: 56-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0437
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009675   Gene: ENSTBEG00000011217   Transcript: ENSTBET00000011198
Sequence length 360
Comment pep:novel scaffold:TREESHREW:scaffold_101440:3069:4151:-1 gene:ENSTBEG00000011217 transcript:ENSTBET00000011198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWKADDQMEKKDQRNPDQPAKQFLILKNQTPIEERGNLIGKTFNLNTDFISLRQVPYKYD
LYEKTLKYNSDLLNSNRNYARKKVDECSRFGKALLYLKQEKIHPGVEYSEYNKTGKVLNH
KEGIFKHQKIKNLVQPFICNYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANL
IKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQ
RIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHT
GEKPYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGDKP
Download sequence
Identical sequences ENSTBEP00000009675 ENSTBEP00000009675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]