SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010338 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010338
Domain Number 1 Region: 69-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000641
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000111
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010338   Gene: ENSTBEG00000011957   Transcript: ENSTBET00000011944
Sequence length 259
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3124:190558:226759:-1 gene:ENSTBEG00000011957 transcript:ENSTBET00000011944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCALARLWPGTLAGCAEAGRCYPGRDPACFVRGWRLDRVYGTCFCDQACRLTGDCCFD
YDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRLVQQEPQNGGAPCPPLEERAGCLEYA
TLQGQDCGHSFVPAFITTSAFNKERTRQAASPQWSKHTEDAGYCMEFKTESLTPHCALEN
RPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWK
KVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences ENSTBEP00000010338 ENSTBEP00000010338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]