SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012034 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012034
Domain Number 1 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 46-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 377-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000176
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012034   Gene: ENSTBEG00000013905   Transcript: ENSTBET00000013890
Sequence length 446
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1134:56515:79149:-1 gene:ENSTBEG00000013905 transcript:ENSTBET00000013890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADHVSQEPQALLETALPSKVLGFSNKAIFGMERLAPVSLKAKPQELVTFEDVAVYF
IRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTQNDREISEDSGSHGVLLGRFQKDI
SQGLKFEEAYEQEVSLKRQLGNSSEEILSRKIQDFGQVTVEKKLTPMGERSEKYNEFGNT
FTVSSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQS
SHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNVMGMSKSSLRVTADLNIREST
Download sequence
Identical sequences ENSTBEP00000012034 ENSTBEP00000012034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]