SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012322 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012322
Domain Number 1 Region: 1260-1525
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 1881-2141
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-44
Family YWTD domain 0.0000136
Further Details:      
 
Domain Number 3 Region: 192-461
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 4 Region: 1648-1831
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-31
Family YWTD domain 0.00019
Further Details:      
 
Domain Number 5 Region: 528-760
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-29
Family YWTD domain 0.0000319
Further Details:      
 
Domain Number 6 Region: 2260-2427
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-25
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 7 Region: 3941-4132
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000011
Family YWTD domain 0.00034
Further Details:      
 
Domain Number 8 Region: 841-883
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 9 Region: 3640-3685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 15-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 11 Region: 921-960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 3356-3400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 1006-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.000088
Further Details:      
 
Domain Number 14 Region: 966-1003
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 15 Region: 2547-2588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 16 Region: 1049-1089
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 17 Region: 3599-3635
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 18 Region: 2588-2627
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 19 Region: 134-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.004
Further Details:      
 
Domain Number 20 Region: 3398-3435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 884-923
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 1175-1254,1824-1873
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000973
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 23 Region: 2938-2977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.021
Further Details:      
 
Domain Number 24 Region: 3323-3353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 25 Region: 795-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family EGF-type module 0.039
Further Details:      
 
Domain Number 26 Region: 66-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 27 Region: 97-182,469-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000113
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 28 Region: 2144-2191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.011
Further Details:      
 
Domain Number 29 Region: 3218-3270
Classification Level Classification E-value
Superfamily YWTD domain 0.0000497
Family YWTD domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000012322
Domain Number - Region: 4184-4219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 2467-2510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000164
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 3681-3717
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0223
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number - Region: 1528-1571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012322   Gene: ENSTBEG00000014004   Transcript: ENSTBET00000014218
Sequence length 4528
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6149:210793:342802:1 gene:ENSTBEG00000014004 transcript:ENSTBET00000014218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPLLSALVVAAVDVPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEIXXXXX
XXXXQPNEHNCLGTELCIPMSRLCNGVHDCMDGSDEGAHCLELRTNCSRLGCQHHCVPTL
DGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSC
KAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVG
DSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCN
RNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVF
PHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNS
DNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGG
CSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVP
DEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVA
VDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGXXXXXXXX
XXXXXXXXXXXXXXXXDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILL
NGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLEGGVGGTPPTSVTLLRSERP
PIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDTDGVTCLANPS
YVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTPSDRFKCENNRCI
PNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDES
ASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCI
PEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDC
MDSSDEKSCEGVTHVCDPNVKFGCKDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCSLNNGCCSHNCSVAPGEGIVCSL
LGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKP
FIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDN
GALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHP
RAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRIL
WIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTG
HNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVSCACPHLM
KLHKDNTTCYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLPNAHGLAVDWSRNLWTSYDTNKKQINVARLDG
SFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSGQKGPVGLAIDF
PESKLYWVSSGNHTINRCNLDGSGLEVIDAMQSQLGKATALAIMGDKLWWADQVSEKMGT
CNKADGSGSVVLRNSTTLVMHMKVYDEGIQLDHEGTNPCSVNNGDCSQLCLPTSETTRSC
MCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHA
XXXTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEV
ARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGSERVVLVNVSI
SWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEGFIYWS
DRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLCL
YRGGGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQINDDGSGRTTIVENVGSVEGLAYH
RGWDTLYWTSYTTSTITRHTVDQSRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNW
NEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHR
YVVLKSEPVHPFGLAVYGEHIFWTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXELSPCRINNGGCQDLCLLTHQGHFNCSCRGRRVLQEDLTCRVVNSSRQPPEVLK
EDTGEIINFRLTWNGISNWKAKIKKLPYCHTRRCKKTFRQCNNGRCVSSMLWCNGADDCG
DGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQDDCRDASDERGCHVNECLSHILSGC
SQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPSSRCINTHGSYXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQDIPHIFALTLFEDYIYWTDWETKS
INRAHKTTGTNKTLLISTLHRPMDLHVFHALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFK
CRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRC
NGQDNCGDGEDERDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDCTPRC
DMDQFQCKSGHCIPLRWRCDADAYCMDGSDEEACATGVRTCPLDEFQCNNTLCKPLAWKC
DGEDDCGDNSDENPEECVQFMCPPNRPFRCKNDRVCLWIGRQCDGTDNCDGTDEEDCEVS
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISGLKIPRGIAIDWVAGNVYW
TDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRRRQALVVCYHQQGLYETDAMFCVIVSFEQAGREPPDSKGLSHPF
SIDVFEDYIYGVTYINNRVFKIHKFGHSLLTNLTGGLNHASDVVLYHQHKQPEVTNPCDR
KKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFNGGSCFLN
ARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTPKCTQQVCAG
YCANNSTCTVNQGNQCRCLPGFLGDRCQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGAKGFQH
QRMTSGAMNVEIGDPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHG
SRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences ENSTBEP00000012322 ENSTBEP00000012322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]