SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014006 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014006
Domain Number 1 Region: 2604-2870
Classification Level Classification E-value
Superfamily BEACH domain 1.1e-110
Family BEACH domain 0.0000000417
Further Details:      
 
Domain Number 2 Region: 2973-3143
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-28
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 2431-2553
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3342-3409
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 368-412,478-556,750-812
Classification Level Classification E-value
Superfamily ARM repeat 0.00000526
Family HspBP1 domain 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000014006
Domain Number - Region: 2241-2318
Classification Level Classification E-value
Superfamily Cyclin-like 0.000748
Family Retinoblastoma tumor suppressor domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014006   Gene: ENSTBEG00000015978   Transcript: ENSTBET00000016124
Sequence length 3418
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3807:81388:296433:-1 gene:ENSTBEG00000015978 transcript:ENSTBET00000016124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASRAIVQFLEINQSEEASRGWMLLTPINLIASSGQKTVDCMTTMSVPSTLVKCLYLFFD
LPHVPEAVGGAQNELPLAERRGLLQKVFVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKECLSTCVQNMQQSDDLSPLEIVEM
FAGLSCFLKDSSDVSQTLLDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSL
TTYGVNELKPAGVTTGAPFLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFEMLEFVVFSLNYIPCKE
LISVSILLKSSSSYHCSIIAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKD
PTQALNEQGDSRNNSSVEDQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVKY
PQCRQHALMTIQQLVLSPNGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSR
TVFRKVGGFVYITSLLVAMERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPAN
SHFFKTEIQYEKLADAVRFLGCFSDLRKISAVNVFPSNTQPFQRLLEEDVISVDSVSPTL
RHCSKLFIYLYKVATDSFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAYHSVSTPPVY
SPKNVADLKLHVTTSSLQSSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANIL
QSLVHTERNQQVMCEAGLHARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLRE
FLRLASPLNCGAWDKKLLKQYRVHKPSSLSYEPEMRSSMITSLEGLGSDNVFSLHEDNHY
RISKSLVKSAEGSTVPLTRVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHYVHSTPGGSGSANPPVV
STVYAYIGTPPAQRQIASLVWRLGPTHFLEEVLPPSNVTTIYELGPNYVGSFQAVCMPXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGISSHEN
ATPVKLIHNSAGHLNGPARTIGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVVMAS
DEGLYAAVKALCVVKSNSLASKEMEXXXXXXLLAMLLKKKRSLLNSHILHLTFSLVGTVD
SGHETSIIPNSTAFQDLLCDFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGQFISSTLPTFAVCEKFV
VMEINNEEKPDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACEELVK
TLGFDWIMMFMEEHLHSTTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNK
IGTVLGFNVGRSAGGRSTVREINRDACHFPGFPVLQSLLPKHTNVPALYFLLMALFLQQP
VSELPENLQVSVPVISSRCKQGGQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLL
GMLRSMLNSPWQSEEEGSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFP
FNIRPYSEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXASPERSTRTQQKEFQTYILDSVMDHLLAADVLL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKRRSQ
GLSLDADYHCLNRTILYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCL
AHCLINLHVGSNVDGFGLEAEARMTTWHIMIPSDIEPDGGYSQDISEGRQLLIKAVNRVW
TELIHSKKQVLEEVFKVTLPVNERGHVDIAIARPLIEEAGLKCWQNHLAHEKKCISRGEA
LMPTTQSKLSRVSSGFGLSKLTGSRRNRKESGLHKHSLSTQEISQWMFTHIAVVRDLVDT
QYKEYQERQQNALKYVTEEWCQIECELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKM
VRNDMFYNHYPYVPETEQETNVASEIPSKQPETSDDIIPQKKPARYRRAISYDSKEYYMR
LASGNPAIVQDAIVESAEGEAAQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDEENQE
QLQDQIAEASSIEEEEKTDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFY
VIDGFTMTATREIRDIETLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYL
LQPIAVEVFSGDGRNYLLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGXX
XXXXXXXXXXXXXXXXESEITSFHMQLNTLGRSYNDLMRYPVFPWILADLDSEEVDLTNP
KTFRNLAKPMGAQTDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPF
TQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLG
CKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVE
AVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDN
AGISVPPGCTSDKIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTW
NKTFAWGYADLSCRLGTYESDKAVTVYECLSEWGQILCAICPNPKLVITGGTSTVVCVWE
MGTSKEKAKTLTLKQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLR
GHRAPVSALCINELTGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIICCCVSEMNEW
DTQNVIVTGHSDGVVRFWRMEFLQVPETPAPEPVEVLEMQEDCPEAQIGQEAQDEDSSDS
EADEPSLSQDAKDVPSQPSSTSHRPRAASCRATAVWCTDSGSDDSRRWSDQLSLDEKDGF
IFVNYSEGQTRAHLQGPLNHPHPNPIEVRNYSRLKPGVRWERQVFRSKLTMHTAFDRKNN
APPARVTAWGFSXXXXXXXXXXXXXXXFSWSVSDQPGRSAAHWVKDEGGDSCSGCSVRFS
LTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences ENSTBEP00000014006 ENSTBEP00000014006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]