SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014371 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014371
Domain Number 1 Region: 94-290
Classification Level Classification E-value
Superfamily Serpins 5.89e-48
Family Serpins 0.0000000135
Further Details:      
 
Domain Number 2 Region: 382-489
Classification Level Classification E-value
Superfamily Serpins 2.88e-36
Family Serpins 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014371   Gene: ENSTBEG00000016541   Transcript: ENSTBET00000016534
Sequence length 492
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2349:130232:136334:1 gene:ENSTBEG00000016541 transcript:ENSTBET00000016534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHVLHPLLVLVVTWVCVGRGLPDQLETGGEPLAPQWEQAGKKNLSMPLLPVDFHKENTV
TNDWIAEGEEDDDYLDLEKIFSEDDDYIDIIDAVSPTDTAASAGNILQLFQGKSRIQRLN
ILNAKFAFNLYRALKDRAGASENIFIAPVGISTAMGMLSLGLKGETHEQVHSILHFKDFV
NASSKYELTTVHNLFRKLTHRLFRRNFGYTLRSVNDLYVQKQFPILEDFKTKVREYYFAE
AQAADFSDPAFISKTNQHILRLTKGLIKDALDSVDPATQMVTLNCVYFKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTREVLLPKFKLEKNYNLVEALKSMGITALFDHNGDLGGI
SDQRIAIDLFKHQGTITVNEEGTQAAAVTTVGFMPLTTQVRFSVDRPFLILVYEHRTSCL
LFMGRVANPLRS
Download sequence
Identical sequences ENSTBEP00000014371 ENSTBEP00000014371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]