SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014413 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014413
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-58
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.61e-35
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014413   Gene: ENSTBEG00000016582   Transcript: ENSTBET00000016577
Sequence length 598
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1514:71007:113801:1 gene:ENSTBEG00000016582 transcript:ENSTBET00000016577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGREFFDFSSGSSHAENILQIFNEFR
DSRLFTDVIICVEGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECF
LQYVYTGKVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSL
KTLFTKCNFALQTFEDVSQHEEFLEDKDELIDYICSDELVIGKEEMVFEAVMRWVYRAVD
LRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRYHILGNEMMSPR
TRPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNRLS
SVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPEANSW
LLRAAIPIAKRCITAVSLNNLVYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMSIC
NGKIYILGGRRENGEATDTILCYDPATGIVTGVAAMPRPVSYHGCVTIHRYNEKCFKL
Download sequence
Identical sequences ENSTBEP00000014413 ENSTBEP00000014413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]