SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTRT_02234 from Pyrenophora tritici-repentis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTRT_02234
Domain Number 1 Region: 406-563
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0093
Further Details:      
 
Domain Number 2 Region: 296-393
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 
Domain Number 3 Region: 46-278
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000138
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTRT_02234
Sequence length 565
Comment | PTRG_02234 | Pyrenophora tritici-repentis rhamnogalacturonate lyase precursor (566 aa)
Sequence
MSAFKFLWLAVLAIAAPVEERSKKPKSFLKVLGNSTWVIGNDVWNVTQNRQYANKLMYKG
KDRVGPAVGHYVSYNGAASDLNWTSAAIVAQDSNWINVRFTAKEGDFHWVIHDGLPGAYQ
YFVNHALPTLGEFRTLWRLDNTSFTHGHTKVKDGVLPPLSEYANATNVQDETWQKADGTF
LTKYDWSDFIREQTYYGVYGDEVGSWYLSPGKDHFNGDHLKQELMIHRESETGDTVQLNM
IHGTHYMAVATDSFADNKVWGPWLWYLNSGSKADAAARWKQELDAWPYKWFDNKAYQSRG
KIQGRLRLSDGRPAAGAAVFLGDNRNTTVSTLDQGQGYYYTTYADADGKFSIHDIRTGTY
ALYAWGNGGALENVISNFTHNDVVIQQGKNTNLKDLTWKVPDCSKRIFQIGDFDRKSDGF
GLADPSKPFEHARIAKCPANLTYAVGKSARKDWCFGQSVEGTWTVVFESRTEAQAKLTLS
LAGFSQGTSADVLLNGVHVGNITSTSLLNSQDTYRGATRAGEWRLLEFGVEKGKLKKGVN
KLDVKVTKSTRWRGWLWDSVVLDVV
Download sequence
Identical sequences B2VV51
XP_001932567.1.10593 PTRT_02234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]