SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 232344 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  232344
Domain Number 1 Region: 123-213
Classification Level Classification E-value
Superfamily eEF-1beta-like 1.03e-32
Family eEF-1beta-like 0.0000219
Further Details:      
 
Domain Number 2 Region: 7-67
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000222
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 232344
Sequence length 213
Comment $ JCSG $ SQ9301 $ PDBT17986 $
Sequence
MVADVKSPAGLAAFNTTLAEQAFATGFVLSGEDAQLFAALGSAPNASTYPNVARWYANVA
SYTDAERKTWASAGGSAPAAAAADGDDFDLFGSDDEEEDAEKAKIVEERLAAYAEKKAKK
AGPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIGYGIKKLQIITVI
EDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI
Download sequence
Identical sequences P34460
CE00548___KOG1668 F54H12.6 F54H12.6 232344 F54H12.6 6239.F54H12.6 NP_498737.1.50509 F54H12.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]