SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 282020 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  282020
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.06e-71
Family Tryptophan biosynthesis enzymes 0.00000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 282020
Sequence length 230
Comment $ JCSG $ SQ9744 $ PDBT18443 $
Sequence
MIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDINADASLEDFIRMYDELADAISILT
EKHYFKGDPAFVRAARNLTCRPILAKDFYIDTVQVKLASSVGADAILIIARILTAEQIKE
IYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIKKNVLWELLPLVPD
DTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENPRRFLEEMRAWSE
Download sequence
Identical sequences NP_227955.1.35502 243274.TM0140 gi|15642914|ref|NP_227955.1| gi|15642914|ref|NP_227955.1| 282020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]