SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 282697 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  282697
Domain Number 1 Region: 9-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-27
Family ABC transporter ATPase domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 282697
Sequence length 234
Comment $ JCSG $ SQ10406 $ PDBT19120 $
Sequence
MKSRKFPIRFENFSLSVDGKSVLENITLSFVEGMNVLYGPRGSGKSSLLRSIVKLNTEIF
NEISRSGSVYLFDQNVEDLDDIYVRKNALYLDTSFIDAMNQYTFDEFLKLALKRKISLEN
FSEKLDDLGILRMLIRGQKTPLSVFSPAEKISLLLFILEQKKPRVILMDCLLDHLDDENL
EKIMDMFLKMKEERTFVISTRILQRFLYIADLLVILNNGRINYTGSPKDFVLRM
Download sequence
Identical sequences Q9WZT4 R4NZB2
gi|15643590|ref|NP_228636.1| NP_228636.1.35502 WP_004080826.1.29620 WP_004080826.1.45724 WP_004080826.1.51363 WP_004080826.1.56403 WP_004080826.1.79805 282697 APC4426 VT24 243274.TM0827 gi|15643590|ref|NP_228636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]