SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283160 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  283160
Domain Number 1 Region: 65-202
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-21
Family Ribonuclease H 0.004
Further Details:      
 
Domain Number 2 Region: 5-50
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.23e-16
Family N-terminal domain of RNase HI 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283160
Sequence length 223
Comment $ JCSG $ SQ10856 $ PDBT19582 $
Sequence
MKLAKKYYAVRKGRVPGIYKTWKEAEEQVKGFPGAEYKSFERLEDAKAYMEGKNECICPE
LDTETMIAYVDGSYDEVCGSGIVLCYRGKKEEYYFWTNIEEFKDSRNITGEIMAALFAMD
YALKKGARKLVLRYDLEGLEKWATEEYRTNKLVTKVYRHYYRKFCQMGLKVVFEKIKSHS
GNFCNDEADSLAKKASKKESNVEWMPEDFESIIRTLTKKGGCL
Download sequence
Identical sequences Q9X122
283160 NP_229100.1.35502 WP_010865300.1.29620 WP_010865300.1.45724 WP_010865300.1.51363 WP_010865300.1.56403 WP_010865300.1.79805 243274.TM1296 gi|15644051|ref|NP_229100.1| gi|15644051|ref|NP_229100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]