SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 321 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000248
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 321
Sequence length 110
Comment $ JCSG $ SQ7884 $ PDBT16603 $
Sequence
STDPMVTYNAILKGLEKWAWPRFVTKEAIDMMLSLCKYEPTERLGFGDIGEIRHHIWFDN
FDFVGFRAHRIRPPFIPSVANDIDTSNFDTFPAFDNFASGSDESGWDIDF
Download sequence
Identical sequences 321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]