SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354371 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354371
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily TPR-like 3.33e-17
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 354371
Sequence length 154
Comment $ JCSG $ SQ12219 $ PDBT20997 $
Sequence
MFSLSTQTMSAVAQRHPQTPISTITASNRQSSLHFKINSNNPEAHAQMRSGDEKGAIASI
TIEFQSVEQLHLHLGIMHLLSGDMKGAIEDFNQAILINPNYAEAYKGRGVAKVQLGDEKE
AIEDLQKAADIFQEQEETAKYQEVINIIRQINDK
Download sequence
Identical sequences Q8YZW2
103690.all0343 354371 NsR356 gi|17227839|ref|NP_484387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]