SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 354447 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  354447
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-21
Family Nucleotide and nucleoside kinases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 354447
Sequence length 190
Comment $ JCSG $ SQ12294 $ PDBT21073 $
Sequence
MTTDPRLMTKLILLIGLPGSGKSTLAKQLVAQCPQMQLISTDAIRGQLFGSEAIQGSWLL
IWREIEQQLQQTVITGKIALFDATNAQRRHRRELITLASELGFTDITGVWIKTPVWLCLA
RNKKRPRQVPEDVILRMHRQLRDAPPILEEGLEHLIVYENIFSPIHNSLLPILSIDKYGN
CPDPVSGNHT
Download sequence
Identical sequences A0A1Z4KMN0 Q8YNC2
103690.all4644 354447 gi|17232136|ref|NP_488684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]