SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 355467 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355467
Domain Number 1 Region: 87-152
Classification Level Classification E-value
Superfamily F-box domain 0.00000458
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  355467
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily TPR-like 0.0683
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 355467
Sequence length 344
Comment $ JCSG $ SQ12979 $ PDBT21817 $
Sequence
MIVDYEKDPRAKEAIAIWEKGVLKEKDGSMSDAINFYRSALKIHDNVESLYRKKILDEWM
LHKKLSGLSMTTDAPDEQNETGKDDLSVEENAELQPCWILEILPDDILLRIIKKVILMSG
ESWVNLSMTCSTFSKLCFHDSVPFKTFAKYIYSKQIYDKMAMDLNGITDINTFEKEIWRG
DDYRMLRERPYIKFEGVYISVVNYVRYGSNAESSLSLLKPVHMITYYRYFRFYENGQCLR
LLSTDEPSAVVKHFSKENKPRHSHMCYWSLGFDYDFGHLKITRSDEKYTFIEEFQIKNQG
NKRYQRLKWLSSIVVDKEGNASNCSLRNEKSFFFSRVKSFKDPG
Download sequence
Identical sequences A0A250WLQ1 E7NKE7 E7Q6L1 G2WIU0 Q12347
YLR097C 4932.YLR097C 355467 YLR097C YLR097C YLR097C NP_013198.1.97178 YLR097C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]