SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 356241 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  356241
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-86
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 356241
Sequence length 240
Comment $ JCSG $ SQ13512 $ PDBT22373 $
Sequence
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Download sequence
Identical sequences 356241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]