SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358534 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358534
Domain Number 1 Region: 36-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-25
Family Glutathione peroxidase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 358534
Sequence length 185
Comment $ JCSG $ SQ198182 $ PDBT23289 $
Sequence
MKVEIRSKVVILLCIVLAVFSSCITDDDDDRGDFALVAGDALPQFSVEMSDGGVLNTQSF
SGKVGVIVFFHTDCPDCQKELPVIQKVYDTYKENPDVLLSCISRSESGSEVQAYWEKHSF
SLPFSAQNDDAVFSLFASHTIPRILITDKEGIIRAVYTDDPLATYQELAKDIDAVLIDKL
SGNER
Download sequence
Identical sequences A0A1H5ZKL1 C6IQZ3 Q8ABE4
226186.BT_0166 gi|29345576|ref|NP_809079.1| NP_809079.1.73244 WP_008766715.1.28290 358534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]