SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 361744 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  361744
Domain Number 1 Region: 15-134
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000275
Family Dual specificity phosphatase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 361744
Sequence length 151
Comment $ JCSG $ SQ113530 $ PDBT25256 $
Sequence
KQPQSKGNKMAILKLDEHLYISPQLTKADAEQIAQLGIKTVICNRPDREEESQPDFAQIK
QWLEQAGVTGFHHQPVTARDIQKHDVETFRQLIGQAESPVLAYCRTGTRCSLLWGFRRAA
EGMPVDEIIRRAQAAGVNLENFRERLDNARV
Download sequence
Identical sequences 361744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]