SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 362307 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362307
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000352
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362307
Sequence length 129
Comment $ JCSG $ SQ114093 $ PDBT25819 $
Sequence
TAEQLEVIYAMAYAHVARCEYGKALPIFAFLAQYGPTRKHYWAGLALCLQKTDRPDEARN
IYALILTLYPDSADAVLRTAECELALGENERAQAALFGAIAIDAESGQPGPVSHRARALL
DLISVSHPE
Download sequence
Identical sequences 362307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]