SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366717 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366717
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000164
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366717
Sequence length 124
Comment $ JCSG $ SQ88650 $ PDBT27653 $
Sequence
MDVKQTLEKAIALRQNKRYQESNAILVTLCKEHAHDPQILYQCGWSFDVLGLEAQAVPYY
EKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYN
LGRY
Download sequence
Identical sequences 366717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]