SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366753 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366753
Domain Number 1 Region: 19-111
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000283
Family Dual specificity phosphatase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366753
Sequence length 111
Comment $ JCSG $ SQ88686 $ PDBT27689 $
Sequence
MPSEKQPQSKGNKMAILKLDEHLYISPQLTKADAEQIAQLGIKTVICNRPDREEESQPDF
AQIKQWLEQAGVTGFHHQPVTARDIQKHDVETFRQLIGQAESPVLAYCRTG
Download sequence
Identical sequences 366753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]