SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 371368 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  371368
Domain Number 1 Region: 156-230
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000032
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 14-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000391
Family Glutathione S-transferase (GST), N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 371368
Sequence length 237
Comment $ JCSG $ SQ117941 $ PDBT30415 $
Sequence
MLTLMTHGGGDGFYSYSMFCTKAALLLQMSGATWQRQDVFDPAELDAMPHQKLPVVRDET
DALIPDSEGIRRFLEAKGANFDQGLSAAQKGQSRALIRMIDESLWTQLMCARWLEDEGWA
GMLQSVFAGVPEEPLNLFREKVVEGLHFTGHSRFDRAERLQRLEQDLCALEDFLGDQHFL
FGDHMTAADCSAAPMLEALSRAPAAPQVVEVTRRHGKLLAYVTRVLDRGALELPQAA
Download sequence
Identical sequences Q1GC91
292414.TM1040_2993 371368 gi|99082833|ref|YP_614987.1| WP_011540303.1.15988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]