SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 371817 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  371817
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.94e-35
Family Nitrogenase iron protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 371817
Sequence length 146
Comment $ JCSG $ SQ100555 $ PDBT30675 $
Sequence
MRLPLNQRVAILLHEGTTGTIGKTGLALLRYSEAPIVAVIDRNCAGQSLREITGIKRDVP
IVKSVEAALEYKPQVLVIGIAPKGGGIPDDYWIELKTALQAGMSLVNGLHTPLANIPDLN
ALLQPGQLIWDVRKEPANLDVASGAA
Download sequence
Identical sequences 371817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]