SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 375677 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  375677
Domain Number 1 Region: 30-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.85e-23
Family Extended AAA-ATPase domain 0.026
Further Details:      
 
Weak hits

Sequence:  375677
Domain Number - Region: 261-338
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00802
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 375677
Sequence length 359
Comment $ JCSG $ SQ128518 $ PDBT33223 $
Sequence
MKDPISFVEEKVKERAKETSNIKSAIIFDMDFKPPRILIRSELNKVTNDLADYVNLNLPR
HIIIYGSKGSGKTLSALTIASAFKESKSIPFFYVNARENPTSIKIYRKLTRIDSRGHDID
EVKSKFDSMLSGKSIVILDEVDFLQDYDILYHLTRHTRANLILLTQKVYWYKDMNDESVK
SSLQPDHIVFHEYSSEEIREILKMRADEGLNKYDKESLGLLSAMLVRDYRSDARIGIKAL
EIIGRLNEWDDDSVRAALKQAYVEVEGETLKNLGDRDLLILAALIKNQDTNRAYSEVSAS
GNMLLRGVSKSTFFQSVNYLQNLGLITLIKKKIGRYYTMESQILLSDESIVLGELRKRI
Download sequence
Identical sequences 273116.TVN1477 gi|13542308|ref|NP_111996.1| 375677 WP_010917733.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]