SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 377805 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  377805
Domain Number 1 Region: 27-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000709
Family Nucleotide and nucleoside kinases 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 377805
Sequence length 235
Comment $ JCSG $ SQ131640 $ PDBT34287 $
Sequence
MTTNILSVISAMAEVATVPRQGDQLRPRQPVITLSRDFGSGGDVIATRVCQRLKLPLYDE
ELLREVAARLNDDPAIVRLMDEGFGRAKDMWLYRLFSGKDISPDAYRDTLVKVVMSLGRL
GGIIVGRGAHIILAGECALRVRVAGSPEVCAKRMAEQGHGNEADLLAKAQEINHRRGKFV
WEAFHSRLSDASQFDLTINTDRMEDFEDVVETIVVMAEAVHSGRVLRGDLIRAHV
Download sequence
Identical sequences A0A0C2YPU6
377805 WP_009870025.1.91102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]