SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 380799 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  380799
Domain Number 1 Region: 4-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-40
Family ABC transporter ATPase domain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 380799
Sequence length 288
Comment $ JCSG $ SQ138547 $ PDBT36431 $
Sequence
MKGIEVKQVTKSFDKKMILNGIGMTIEPNKIYGLLGRNGAGKSTLLSLLVNRIAPDTGEI
RLDNKVIRDNDEQLSKMFLMSEVDLYPKNLKVKDVFKWTKSFYGGFDEELAQDLCEKFGL
QTNIIFNKLSTGYRTIMKLIVALAVPVEYVFLDEPILGLDAGHREIFYNALVETYAENPR
TFVISTHLIEEIANLIEHVLVIDHGRLIVDDETEKVLGEAYVVSGPEDKVDEYTQGLNVI
GSDKLARIKASYVFGSLDNKPISDLINIDQMDLQTLFVNLTNGGNENE
Download sequence
Identical sequences A0A0R2H8F5 Q03EM4
278197.PEPE_1307 380799 WP_002833695.1.1876 WP_002833695.1.35559 WP_002833695.1.46652 WP_002833695.1.5355 WP_002833695.1.5834 WP_002833695.1.65682 WP_002833695.1.66730 WP_002833695.1.67299 WP_002833695.1.94842 WP_002833695.1.97541 gi|116493055|ref|YP_804790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]